Protein Info for Pf6N2E2_2688 in Pseudomonas fluorescens FW300-N2E2

Annotation: YD repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR03696: RHS repeat-associated core domain" amino acids 102 to 181 (80 residues), 80.2 bits, see alignment E=6.4e-27

Best Hits

Predicted SEED Role

"YD repeat protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW48 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Pf6N2E2_2688 YD repeat protein (Pseudomonas fluorescens FW300-N2E2)
MDISNKTEQRASDEATIIFHYDALDTLIGRDTADGKERRFYRGDELASEVSGTVSTTFVR
AEGVVLAERQTGGDASSILLMGDDKNSVMGEVTRQGLTSIAYSPYGHRVEGSSANSHLGY
NGERRERQTGWYLLGKGYRVFNPQLMRFHSPDNLSPFGKGGLNAYMYCVGDPINNVDPTG
HGFIGAVSRFFRKPAAFSVGETTSGIFTLTKHRVKPPSLRVIGSEDVLNAQKNVAYFDVM
VRKYEAKFIEISDLEVSPEIVSNMISEQDFFRGKTISALKNYEFALRHKGEVGITRRGAK
KLEALAEVYDKMMKNIPGQERAEHLASVEDRVRTAAEMKNIRE