Protein Info for Pf6N2E2_2687 in Pseudomonas fluorescens FW300-N2E2

Annotation: COGs COG3146

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF04339: FemAB_like" amino acids 9 to 373 (365 residues), 496.8 bits, see alignment E=4.4e-153 PF13480: Acetyltransf_6" amino acids 185 to 320 (136 residues), 57 bits, see alignment E=2.5e-19

Best Hits

KEGG orthology group: K09919, hypothetical protein (inferred from 97% identity to pba:PSEBR_a1400)

Predicted SEED Role

"COGs COG3146"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWA3 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Pf6N2E2_2687 COGs COG3146 (Pseudomonas fluorescens FW300-N2E2)
MPLHVLDSLSAIAPQEWDALVPANQPFLRHAFLSTLEDSASLGPQSGWQPEHLLHIEDGR
LLAALPSYRKWHSYGEYVFDHAWADACARAGIEYYPKLLTAVPFSPVSGPRLLAARVEDG
LELLGSLPGYLEIEGLSSAHINFTDAFTDAALAGQEGWLQRIGCQYHWQNRGYRDFQDFL
DALSSRKRKQMRKEREQVAGQGIEFEWLEGQQLDEAQWDFVYACYANTYAVRRQAPYLTR
AFFSLLAERMPEAIRVVLAKQGSRPVAMAFSLVGGDSFYGRYWGCLAEFDRLHFETCFYQ
GMDYAIAHGLQRFDAGAQGEHKLIRGFEPVITRSWHYLRHPGLKAAVADFLVREQEGVLA
YAEEAKTALPYRQC