Protein Info for Pf6N2E2_266 in Pseudomonas fluorescens FW300-N2E2

Annotation: NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 463 to 480 (18 residues), see Phobius details TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 3 to 497 (495 residues), 571.7 bits, see alignment E=6.3e-176 PF00361: Proton_antipo_M" amino acids 134 to 430 (297 residues), 234.1 bits, see alignment E=1.1e-73

Best Hits

Swiss-Prot: 82% identical to NUOM_PSEAE: NADH-quinone oxidoreductase subunit M (nuoM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00342, NADH dehydrogenase I subunit M [EC: 1.6.5.3] (inferred from 99% identity to pba:PSEBR_a3592)

MetaCyc: 90% identical to NADH-quinone oxidoreductase subunit M (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YPX1 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Pf6N2E2_266 NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3) (Pseudomonas fluorescens FW300-N2E2)
MILPWLILIPFIGGLLCWIAERSSSTLPRWIALLTMSLELALGLWLWATGDYSFAPAPGA
DPTWALEFKHIWIERFGISVHLALDGLSLLMILLTGLLGILSVLCSWKEIQRHVGFFHLN
LMWILGGVIGVFLALDLFMFFFFWEMMLVPMYFLIALWGHSSSDGKKTRIYAATKFFIFT
QASGLIMLVAILGLVLVNFNNTGVITFNYADLLKVQMSKTTEYVLMLGFFIAFAVKLPVV
PFHSWLPDAHAQAPTAGSVDLAGILLKTAAYGLLRFALPLFPNASAEFAPIAMTLGLIGI
FYGAFLAFAQTDIKRLIAFSSVSHMGFVLIGIYSGSQLALQGAVIQMLAHGLSAAALFIL
SGQLYERLHTRDMREMGGIWSRIAYLPAISLFFAAASLGLPGTGNFVGEFLILIGSFVSS
PWITAIATSGLVFGSVYSLIMIHRAYFGPSKSDEVLRGMDGRELIMVLGLAVLLVYLGVS
PQPFLDTSAATMHGVQQWLGTAFSQLASAR