Protein Info for Pf6N2E2_2644 in Pseudomonas fluorescens FW300-N2E2
Annotation: Transcriptional regulator SlyA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 38% identical to SLYA_YERPE: Transcriptional regulator SlyA (slyA) from Yersinia pestis
KEGG orthology group: K06075, MarR family transcriptional regulator, transcriptional regulator for hemolysin (inferred from 99% identity to pba:PSEBR_a1436)Predicted SEED Role
"Transcriptional regulator SlyA"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0D9B1Y8 at UniProt or InterPro
Protein Sequence (144 amino acids)
>Pf6N2E2_2644 Transcriptional regulator SlyA (Pseudomonas fluorescens FW300-N2E2) MPLTDQHRFGMQLAQMSRGWRAELDRRLAGLGLSQARWLVLLHLARFEQAPTQRELAQSV AVEGPTLARLLDSLETQGLVQRQAVAEDRRAKKIVLCAPALPLIEQIETIATQLRRELFE GVDEADMRVCMRVHGTILANLEKS