Protein Info for Pf6N2E2_2634 in Pseudomonas fluorescens FW300-N2E2

Annotation: Potassium uptake protein TrkH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 8 to 31 (24 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 331 to 355 (25 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details amino acids 457 to 482 (26 residues), see Phobius details PF02386: TrkH" amino acids 43 to 478 (436 residues), 207.3 bits, see alignment E=1.8e-65

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 99% identity to pba:PSEBR_a1446)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW13 at UniProt or InterPro

Protein Sequence (484 amino acids)

>Pf6N2E2_2634 Potassium uptake protein TrkH (Pseudomonas fluorescens FW300-N2E2)
MALPTLRIIGFIIGIFLITLAIFMVVPMATLMVFERTADLPSFLWSSMITFVAGLALVLP
GRPEHIHLRPRDMYLLTVSSWLVVCIFAALPFLLTQKISYTDSFFESMSGITATGATVLS
GLDTMSPGILMWRSLLHWLGGIGFIGMAVAILPLLRIGGMRLFQTESSDRSEKVMPRSHM
VARLIVASYVGITILGTLALWWAGMSLFDAINHAMSAISTGGFSTSDLSLAKWTQPAVHW
VAIVIMILGSLPFALYVSMLRGNRRALIKDQQVQGLIGVLLVTWLVLGTWYWATTDLHWL
DALRHVALNVTSIVTTTGFALGDYSLWGNFSLMLFFYLGFVGGCSGSTAGGIKIFRFQVA
YILLRANLNQLIHPRAVIKQKYNGHRLDEEIVRSILTFSFFFAITICVIALLLSLLGVEW
MTALTGAASTVSGVGPGLGETIGPAGNFAPLPDAAKWILSAGMLLGRLEIITVFVLCIPA
FWRH