Protein Info for Pf6N2E2_2629 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phenylalanine hydroxylase transcriptional activator PhhR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF00158: Sigma54_activat" amino acids 208 to 374 (167 residues), 201.7 bits, see alignment E=1.8e-63 PF14532: Sigma54_activ_2" amino acids 211 to 379 (169 residues), 60.3 bits, see alignment E=6.4e-20 PF18024: HTH_50" amino acids 466 to 514 (49 residues), 59.3 bits, see alignment 6e-20 TIGR04381: TyrR family helix-turn-helix domain" amino acids 469 to 516 (48 residues), 87.7 bits, see alignment 2e-29

Best Hits

KEGG orthology group: K03721, transcriptional regulator of aroF, aroG, tyrA and aromatic amino acid transport (inferred from 99% identity to pba:PSEBR_a1451)

Predicted SEED Role

"Phenylalanine hydroxylase transcriptional activator PhhR" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYT6 at UniProt or InterPro

Protein Sequence (520 amino acids)

>Pf6N2E2_2629 Phenylalanine hydroxylase transcriptional activator PhhR (Pseudomonas fluorescens FW300-N2E2)
MRIKVHCQNRIGILRDILNLLVEYGINVARGEVGGEHGNAIYLHCPNLINIQFQALRPKF
EGIAGVFGVKRVGLMPSERRHMELNALLGALEFPVLSIDMGGSIVAANRAAAQLLGVRVD
EVPGIPLSRYAEDFDLPELVRANQSRINGLRVKVKGDVFLADIAPLQSEHDDSEAMAGAV
LTLHRADRVGERIYNVRKQELRGFDSIFQSSKVMAAVVREARRMAPLDAPLLIEGETGTG
KELLARACHLASPRGQSPLMALNCAGLPESMAETELFGYGPGAFEGARAEGKLGLLELTA
GGTLFLDGVGEMSPRLQVKLLRFLQDGCFRRVGSDEEVYLDVRVICATQVDLSELCARGE
FRQDLYHRLNVLSLHIPPLRECLDGLAPLVEHFLDQASRQIGCPLPKLAPAAMERLSRYH
WPGNVRQLENVLFQAVSLCDGGTVKAEHIRLPDYGVRQPLGDFSLEGGLDEIVGRFEKAV
LERLYSEHPSSRQLGKRLGVSHTTIANKLREYEVGKDPSA