Protein Info for Pf6N2E2_2624 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF10135: Rod-binding" amino acids 54 to 105 (52 residues), 61.6 bits, see alignment 8e-21 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 257 to 419 (163 residues), 205.5 bits, see alignment E=8.1e-65 PF01832: Glucosaminidase" amino acids 282 to 419 (138 residues), 125.4 bits, see alignment E=2.1e-40

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 95% identity to pba:PSEBR_a1463)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GMQ7 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Pf6N2E2_2624 Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-) (Pseudomonas fluorescens FW300-N2E2)
MVDMRKGALISGDSASYSDLNRLNQLKVGDKNSDGNLRKVAQEFESLFIGEMLKSMRSAT
EVLGKDNPMNTPEAKQYQEMYDQQLAVSMSREGGGIGLADVLLRQMSKNKPTAPGEAATL
SAAKQQDALDKVAKRVPTPVAAGTLPTDGPLSRSNGQRPLWASRAVSTPQGAEGIHRNDM
ELLNQRRLALPPKLADRLLAGLVPSAAVNADVPAQNVLTDRAIAAVKPATGELANGDWLA
ALKAAEPKGDMQVYGRAVAQPPLAPARKAFRDADEFVNAMLPMAKEAADRIGVDPRYLVA
QAALETGWGKSVMRQPDGSSSHNLFGIKASANWKGDSARAITSEFRNGAMVKETAEFRSY
ASYRDSFHDLVNLLQSNSRYQDVLKSADKPEQFVRELQKAGYATDPNYANKISNIARQMT
SYQNYASAGATTTL