Protein Info for Pf6N2E2_2618 in Pseudomonas fluorescens FW300-N2E2

Annotation: Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR02622: CDP-glucose 4,6-dehydratase" amino acids 7 to 353 (347 residues), 473.6 bits, see alignment E=2e-146 PF04321: RmlD_sub_bind" amino acids 12 to 170 (159 residues), 28.1 bits, see alignment E=2.3e-10 PF01370: Epimerase" amino acids 13 to 238 (226 residues), 103.6 bits, see alignment E=2.3e-33 PF16363: GDP_Man_Dehyd" amino acids 14 to 176 (163 residues), 102.1 bits, see alignment E=8.7e-33 PF02719: Polysacc_synt_2" amino acids 65 to 200 (136 residues), 32.3 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: K01709, CDP-glucose 4,6-dehydratase [EC: 4.2.1.45] (inferred from 90% identity to pfo:Pfl01_1511)

MetaCyc: 52% identical to CDP-D-glucose-4,6-dehydratase monomer (Yersinia pseudotuberculosis)
CDP-glucose 4,6-dehydratase. [EC: 4.2.1.45]

Predicted SEED Role

"Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)" (EC 4.2.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXS5 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Pf6N2E2_2618 Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45) (Pseudomonas fluorescens FW300-N2E2)
MGLNPEFWRGKRVLVTGHTGFKGSWLTLWLQSLGAQVCGFSLDPATKPSLFELARVGEGI
DDRRADLRDLGALLEVLADVQPQIVLHLAAQPLVREGYRDPLGTYSSNVMGTLNLLEAIR
QIGGVRACVLVTTDKVYANQEWLWPYRENEPLGGHDPYSSSKACCELLAQSYAASFFSAE
RFAEHGLALATARAGNVLGGGDFAPERLIPDVLKAWSADEPVTLRYPQAVRPWQHALEPL
AGYLQLAAGLYEQGPEFAGAWNFGPGEADMCSVGEVVQLLAERWPQAPGLRIEPSDLHEA
GLLRLDSSRARQSLGWQPRWSLQQCLAQTLDWHLAWQNGDDMRQVTLGQLNLYRGTL