Protein Info for Pf6N2E2_2617 in Pseudomonas fluorescens FW300-N2E2

Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00908: dTDP_sugar_isom" amino acids 9 to 178 (170 residues), 193 bits, see alignment E=1.7e-61

Best Hits

Swiss-Prot: 46% identical to RMLC_PSEAE: dTDP-4-dehydrorhamnose 3,5-epimerase (rmlC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 90% identity to pfo:Pfl01_1512)

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.13

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZA06 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Pf6N2E2_2617 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Pseudomonas fluorescens FW300-N2E2)
VSEFALKALPLAGLFSVQHKRFEDQRGHFARLFCEGSLSAFGQPFHIRQINHSCTRERGS
VRGLHYQNAAQPEAKLITCLRGEVWDVAVDLRPNSETFLHWHAEQLKAGDGRSLLIPAGF
AHGFQTLTDDAELLYLHSADYAPEHEGGLSVSDPRLAIAWPLPVNNLSTRDSSHPLLDER
FAGVCL