Protein Info for Pf6N2E2_2611 in Pseudomonas fluorescens FW300-N2E2

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR03589: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)" amino acids 1 to 327 (327 residues), 568.9 bits, see alignment E=1.3e-175 PF05368: NmrA" amino acids 5 to 121 (117 residues), 28.6 bits, see alignment E=4.3e-10 PF04321: RmlD_sub_bind" amino acids 7 to 174 (168 residues), 37.5 bits, see alignment E=6e-13 PF01370: Epimerase" amino acids 7 to 193 (187 residues), 85.2 bits, see alignment E=2e-27 PF02719: Polysacc_synt_2" amino acids 7 to 280 (274 residues), 340.5 bits, see alignment E=3.2e-105 PF16363: GDP_Man_Dehyd" amino acids 8 to 126 (119 residues), 43.3 bits, see alignment E=1.4e-14 PF01073: 3Beta_HSD" amino acids 9 to 131 (123 residues), 66.6 bits, see alignment E=7.8e-22 PF13460: NAD_binding_10" amino acids 11 to 129 (119 residues), 47.2 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 62% identical to PSEB_CAMJE: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_1518)

MetaCyc: 58% identical to UDP-N-acetylglucosamine 4,6-dehydratase subunit (Helicobacter pylori 26695)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z9Z7 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Pf6N2E2_2611 UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-) (Pseudomonas fluorescens FW300-N2E2)
MFNGKSIFISGGTGSFGRNFIRRLLEQYQPKRVVVFSRDELKQYEMQQTFNAPCMRYFLG
DVRDADRLRQAMRGIDYVVHAAALKQVPAAEYNPTECIRTNVNGAENIIAAAIDNGVKKV
VALSTDKAASPINLYGATKLLSDKLFVAANNIAGEQQTRFAVVRYGNVAGSRGSVVPFFS
KLIADGATQLPITDERMTRFWITLDHGVQFVLDSFARMHGGEVFVPKIPSIRIVDLASGM
AGHLPHKNVGIRPGEKLHELMVPLDDARMTIEFADHYTIQPSIRFTSVDVDFGVDNLGER
GKPVAEDFEYRSDTNPHFLSVEQIADLHARLSA