Protein Info for Pf6N2E2_2610 in Pseudomonas fluorescens FW300-N2E2

Annotation: Bacillosamine/Legionaminic acid biosynthesis aminotransferase PglE; 4-keto-6-deoxy-N-Acetyl-D-hexosaminyl-(Lipid carrier) aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR03588: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase" amino acids 1 to 384 (384 residues), 558.2 bits, see alignment E=4.1e-172 PF01041: DegT_DnrJ_EryC1" amino acids 9 to 381 (373 residues), 371.4 bits, see alignment E=5.6e-115 PF00155: Aminotran_1_2" amino acids 32 to 165 (134 residues), 22.5 bits, see alignment E=6.3e-09

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfo:Pfl01_1519)

Predicted SEED Role

"Bacillosamine/Legionaminic acid biosynthesis aminotransferase PglE; 4-keto-6-deoxy-N-Acetyl-D-hexosaminyl-(Lipid carrier) aminotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVZ7 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Pf6N2E2_2610 Bacillosamine/Legionaminic acid biosynthesis aminotransferase PglE; 4-keto-6-deoxy-N-Acetyl-D-hexosaminyl-(Lipid carrier) aminotransferase (Pseudomonas fluorescens FW300-N2E2)
MIPYGRQSLDQADIDAVVAVLQSDWLTQGPTLEHFEEAMANRCQAAYAVAVCNATAALHI
ACLAAGLGSGDRLWTTPNTFLASANCGRYCGALVDFVDIDPLTWNLDACALAAKLEEAER
DGTLPKVLVAVAFSGQSCDMRHIAQLSERYGFTVIEDASHAVGASYAGRPVGCGEFAAMT
VFSFHPVKIITSGEGGMVLTNRPELAQRLQRLRSHGMTRDAQQMTEPSHGPWYYQQVELG
FNYRMTDLQAALGLSQLNKLDDFIARRRERVARYNHLLAGLPLVLPGLQPEAESAWHLYV
VRLQLDSITLGHRQVFEGLRAAGIGVNLHYIPVHLQPYYRDLGFAAGDFPQAERYYAEAI
SLPMFPTLSDEQQDYVVEQLREMLEE