Protein Info for Pf6N2E2_2597 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar regulatory protein FleQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF06490: FleQ" amino acids 6 to 123 (118 residues), 95.6 bits, see alignment E=7.1e-31 PF00158: Sigma54_activat" amino acids 146 to 313 (168 residues), 258.6 bits, see alignment E=6.8e-81 PF14532: Sigma54_activ_2" amino acids 147 to 317 (171 residues), 64.5 bits, see alignment E=4.1e-21 PF07728: AAA_5" amino acids 170 to 288 (119 residues), 33 bits, see alignment E=1.7e-11 PF25601: AAA_lid_14" amino acids 318 to 398 (81 residues), 77.6 bits, see alignment E=1.6e-25 PF02954: HTH_8" amino acids 441 to 478 (38 residues), 40.9 bits, see alignment 4.1e-14

Best Hits

KEGG orthology group: K10941, sigma-54 specific transcriptional regulator, flagellar regulatory protein A (inferred from 100% identity to pba:PSEBR_a1474)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W3X6 at UniProt or InterPro

Protein Sequence (491 amino acids)

>Pf6N2E2_2597 Flagellar regulatory protein FleQ (Pseudomonas fluorescens FW300-N2E2)
MWRETKILLIDDDSVRRRDLAVILNFLGEENLPCGSHDWQQAVGSLSSSREVICVLIGTV
NAPATLLGLLKTLSTWDEFLPVLLMGENSSLDLPEDQRRRVLSTLEMPPSYSKLLDSLHR
AQVYREMYDQARERGRHREPNLFRSLVGTSRAIQHVRQMMQQVADTDASVLILGESGTGK
EVVARNLHYHSKRREAPFVPVNCGAIPAELLESELFGHEKGAFTGAITSRAGRFELANGG
TLFLDEIGDMPLPMQVKLLRVLQERTFERVGSNKTQSVDVRIIAATHKNLESMIEVGSFR
EDLYYRLNVFPIEMAPLRERVEDIPLLMNELISRMEHEKRGSIRFNSAAIMSLCRHGWPG
NVRELANLVERMAIMHPYGVIGVNELPKKFRYVDDEDEQMVDSLRSDLEERVAINGHTPD
FTANALLPPEGLDLKDYLGGLEQGLIQQALDDANGIVARAAERLRIRRTTLVEKMRKYGM
SRREGDEQADD