Protein Info for Pf6N2E2_2578 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 44 to 61 (18 residues), see Phobius details amino acids 73 to 114 (42 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 178 to 203 (26 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 15 to 255 (241 residues), 252.8 bits, see alignment E=1.8e-79 PF01311: Bac_export_1" amino acids 16 to 246 (231 residues), 226.2 bits, see alignment E=2.1e-71

Best Hits

Swiss-Prot: 38% identical to FLIR_PECCC: Flagellar biosynthetic protein FliR (fliR) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 94% identity to pba:PSEBR_a1493)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVX5 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Pf6N2E2_2578 Flagellar biosynthesis protein FliR (Pseudomonas fluorescens FW300-N2E2)
MSMLALTDTQISTWVASFILPLFRVTAVLMSMPVFGTTLVPTRVRLYFALAITVVIAPGL
PPMPPVNALDLSGLMLIAEQILIGALMGFSLQLFFQAFVVAGQIISIQMGMAFASMIDPT
NGVNTAVIGQFLTMLVTLLFLAMNGHLVVFEVLTESFTTMPVGSALLVNHFWEIAGKLGW
VLGAAMVLVLPAITALLIVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMVIFWVSLGDILN
QYQPLATQALQLLRDMAQAR