Protein Info for Pf6N2E2_256 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 136 to 156 (21 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details PF03992: ABM" amino acids 22 to 97 (76 residues), 34.9 bits, see alignment E=1.4e-12 PF27539: Y2318_C" amino acids 128 to 197 (70 residues), 49.9 bits, see alignment E=3.4e-17

Best Hits

KEGG orthology group: K09932, hypothetical protein (inferred from 90% identity to pba:PSEBR_a3600)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YPN0 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Pf6N2E2_256 putative membrane protein (Pseudomonas fluorescens FW300-N2E2)
MSESHTIGSPASPAKPGFDEIVTLVVKHRIKAGQDAAYEAWLRRIVSVAGQWPGHLGVDV
VRGKRGGLSLFTCVLRFCSTEAMQRWLDSPERRELVEEATPLLADGDQTEVAPHKEFWFA
PLADAATPPPRWKQSVVTLLVILPHTLLVPLIWGPLLQLNAFLSNYVVATFLITLTIVLS
VVYVFMPLATRLFAPWMEASKAHEHLEPADGQ