Protein Info for Pf6N2E2_253 in Pseudomonas fluorescens FW300-N2E2

Annotation: Non-heme chloroperoxidase (EC 1.11.1.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00561: Abhydrolase_1" amino acids 22 to 255 (234 residues), 116.9 bits, see alignment E=3.1e-37 PF12146: Hydrolase_4" amino acids 23 to 121 (99 residues), 51.7 bits, see alignment E=1.9e-17 PF12697: Abhydrolase_6" amino acids 23 to 263 (241 residues), 77.1 bits, see alignment E=7.8e-25 PF00326: Peptidase_S9" amino acids 189 to 272 (84 residues), 29.3 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 82% identical to PRXC_PSEFL: Non-heme chloroperoxidase (cpo) from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a3603)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YPI7 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Pf6N2E2_253 Non-heme chloroperoxidase (EC 1.11.1.10) (Pseudomonas fluorescens FW300-N2E2)
MSTFITRDGTEIYYKDWGSGQPVVFSHGWPLNSDSWEAQMMFLASNGYRVIAHDRRGHGR
SSQPWDGNDMDTYADDLAELIERLDLKDAVLLGFSTGGGEVARYIGRHGAARVAKLGLIS
AVTPLMLKTPANPGGLPVEVFDGFRQASLADRSQLYKDVASAFFGANRPGAKVSQGMIDW
FWMQGMLAGHKNTYDCIKAFSETDLSEDLRNIDVPTLVVHGDDDQVVPIETAGIAAAKLL
KNSQLLVYPGAPHGLTDTHKDRLNADLLAFIQG