Protein Info for Pf6N2E2_2527 in Pseudomonas fluorescens FW300-N2E2

Annotation: Oxidoreductase, short chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 14 to 210 (197 residues), 157.8 bits, E=3.7e-50
• PF08659: KR
  • amino acids 16 to 186 (171 residues), 42 bits, E=1.5e-14
• PF13561: adh_short_C2
  • amino acids 20 to 243 (224 residues), 125.3 bits, E=4.5e-40

Best Hits

Swiss-Prot: 52% identical to YCIK_ECOLI: Uncharacterized oxidoreductase YciK (yciK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1543)

MetaCyc: 54% identical to CAI-1 synthase (Vibrio cholerae O1 biovar El Tor str. N16961)
1.1.1.-

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

• autoinducer CAI-1 biosynthesis (2/3 steps found)

Sequence Analysis Tools

See A0A159ZXU8 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Pf6N2E2_2527 Oxidoreductase, short chain dehydrogenase/reductase family (Pseudomonas fluorescens FW300-N2E2)
MFDYSARPDLLNGRVILVTGAGRGIGAAAAKAYAAHGATVLLLGKTEANLTQVYDEIEAA
GHPQPAVIPFNLETALPHQYDELAAMIETEFGHLDGLLHNASIIGPRTPLEQLSGENFMR
VMHVNVNAMFMLTSTLLPLLKLSQDASVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTL
ADEVDTVAAVRANSINPGATRTSMRAQAYPGENPLNNPTPEEIMPVYLYLMGPDSTGVNG
QAFNAQ