Protein Info for Pf6N2E2_2514 in Pseudomonas fluorescens FW300-N2E2

Annotation: regulator of length of O-antigen component of lipopolysaccharide chains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details PF02706: Wzz" amino acids 12 to 107 (96 residues), 68.4 bits, see alignment E=5.6e-23 PF13807: GNVR" amino acids 306 to 338 (33 residues), 28.5 bits, see alignment 1.2e-10

Best Hits

KEGG orthology group: K05789, chain length determinant protein (polysaccharide antigen chain regulator) (inferred from 74% identity to pba:PSEBR_a1556)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVX3 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Pf6N2E2_2514 regulator of length of O-antigen component of lipopolysaccharide chains (Pseudomonas fluorescens FW300-N2E2)
MQNDRIDARRDDEIDLIELVRGLWAQKKLILGVTLLITAGAGLYAFLSKPVYEAKLFIMP
PTQNGIAELNYGRGKSSELDIYSIGYVYEVFARNLQAESLRRKFFNEVYLPSLSESQRDG
ALDQVYVRFSRELVIKRPGKDAPDLYLVAVKNEDPVRATEWAKTYVKLASEAAESELIKN
VKAEASVRARNLEQRIISLRENAQRIREDRVQQLREALNIAQAIGLTTPSVNSTAAVDIT
VETGNKLDYQRGSKALSAEVEALQARSSDDAFIPDLRSLQMRYYFYSKLNIDPESISVYR
QDGTVELPESPIKPKKMMILLLGVIGGVLLGCSVALLRILFSRSDRNPV