Protein Info for Pf6N2E2_2507 in Pseudomonas fluorescens FW300-N2E2

Annotation: Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 5 to 104 (100 residues), 91.7 bits, see alignment E=2.5e-30

Best Hits

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>Pf6N2E2_2507 Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-) (Pseudomonas fluorescens FW300-N2E2)
LFGHEFALSWVGHVLAVVYLVWMLNLYNFMDGIDGIASVEAICVCLGACAIYWLGGFNGL
ILAPLMLAMVVAGFLYWNFPPARIFMGDAGSGFLGIILGLLSLQAAWVSPKLLWVWLILL
GVFIVDATVTLMRRLLRGDKVYEAHRSHAYQFASRQYGRHLPVTLAVGAINLFWLLPLAA
CVVWWNVDGGLALTVAYAPLVFLAVRFHAGELEKV