Protein Info for Pf6N2E2_2500 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 7 to 326 (320 residues), 94 bits, see alignment E=5e-31

Best Hits

KEGG orthology group: None (inferred from 51% identity to pfo:Pfl01_2826)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVW4 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Pf6N2E2_2500 Putative membrane protein (Pseudomonas fluorescens FW300-N2E2)
MNQKRINEIDLLRFIAAMSVVFFHYTFRGYAADDRSLLPYPLLAPVAKYGYLGVELFFMI
SGFVIMMTAGGEGFRRFLISRAVRLYPAFWVCCSITFVVTLALGRDRFSATAPQYLGNLT
LMGDFFDIRPIDGVYWSLFIEIRFYFLIALVMLLRQLHRIEALLCVWLVLSVALEFTDAR
GWRRFFITEYSTYFIAGAMFYHVWLSGASKLRWATIISSCAFAIYQGINMLPRLERHYHV
DFDAVIVAATIFISYVVMGFVAKKKMGWVAGRRWVVLGVITYPLYLLHQNVGFMVFNALY
PAVNPHLLLWGTVTLMIAMSLFIHVVFERTMARQLRRVLDHIGNKIAVLFTGGFERLKSY
RPK