Protein Info for Pf6N2E2_2479 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcription elongation factor GreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 TIGR01461: transcription elongation factor GreB" amino acids 12 to 165 (154 residues), 250.6 bits, see alignment E=2.4e-79 PF03449: GreA_GreB_N" amino acids 14 to 83 (70 residues), 82 bits, see alignment E=2.8e-27 PF01272: GreA_GreB" amino acids 92 to 164 (73 residues), 94.2 bits, see alignment E=3.8e-31

Best Hits

Swiss-Prot: 82% identical to GREB_PSEAE: Transcription elongation factor GreB (greB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04760, transcription elongation factor GreB (inferred from 99% identity to pba:PSEBR_a1602)

Predicted SEED Role

"Transcription elongation factor GreB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXG4 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Pf6N2E2_2479 Transcription elongation factor GreB (Pseudomonas fluorescens FW300-N2E2)
MSRYRPPRTAGTALITPEGEARMRAEFHELWHVRRPQVTQAVSEAAAQGDRSENAEYTYG
KKMLREIDSRVRFLTKRLEALKVVSEKPSDPNKVYFGAWVTVEDEDGKESRYRIVGPDEL
DLKQNLISIDSPLARALIGKALDAEVSVQTPTGEKRVYIVDITYP