Protein Info for Pf6N2E2_2452 in Pseudomonas fluorescens FW300-N2E2

Annotation: Spermidine synthase (EC 2.5.1.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01564: Spermine_synth
  • amino acids 60 to 174 (115 residues), 27.5 bits, E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a1624)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• spermidine biosynthesis I (1/2 steps found)
• superpathway of polyamine biosynthesis I (5/8 steps found)
• superpathway of polyamine biosynthesis II (5/8 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutathione metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

See A0A159ZXP5 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Pf6N2E2_2452 Spermidine synthase (EC 2.5.1.16) (Pseudomonas fluorescens FW300-N2E2)
MTEERVEHLLAEVHDEFGMIRVFEVADYRFLEFGDAIEQSCVFTADPSWLEYDYTRAMLI
GALCHEQPESALFLGLGAGTLTQACLKFLPLEDVEAIELRPDVPRLAIEYLGLDDDPRLY
IRVGDALELLESAEPADLIFVDLYTDVGPGVGHLAWGFLENCQKRLNPGGWLVINQWATD
DGKPLGAALLRGLYHRHYWELPVKEGNVILIVPADLDQELDMQGLVARAEGLAPRLGYSL
QSLIKAIRPAT