Protein Info for Pf6N2E2_2440 in Pseudomonas fluorescens FW300-N2E2

Annotation: Free methionine-(R)-sulfoxide reductase, contains GAF domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01590: GAF
  • amino acids 51 to 152 (102 residues), 52.1 bits, E=1.1e-17
• PF13185: GAF_2
  • amino acids 53 to 152 (100 residues), 51.7 bits, E=1.2e-17

Best Hits

Swiss-Prot: 60% identical to MSRC_ECOLI: Free methionine-R-sulfoxide reductase (msrC) from Escherichia coli (strain K12)

KEGG orthology group: K07170, GAF domain-containing protein (inferred from 98% identity to pba:PSEBR_a1635)

MetaCyc: 60% identical to free methionine-(R)-sulfoxide reductase (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]

Predicted SEED Role

"Free methionine-(R)-sulfoxide reductase, contains GAF domain"

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.14

Sequence Analysis Tools

See A0A159ZZI3 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Pf6N2E2_2440 Free methionine-(R)-sulfoxide reductase, contains GAF domain (Pseudomonas fluorescens FW300-N2E2)
MIDLKGTGVGLDGYALLSAQLESLLADERDFIANAAQFSAFLSSQLDDLNWAGFYLNRNE
ELVLGPFQGQIACVRIPFGRGVCGTAAATRQTQRVEDVHAFAGHIACDSASNSELVVPLV
KDGRLIGVLDLDSPKLARFTEHDQAGIEQLAAIFLRLTDC