Protein Info for Pf6N2E2_2427 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): DNA damage response gene with a putative DNA binding domain and often regulated by LexA (PA0922-like)
Rationale: Conserved and specific phenotype: important for resisting cisplatin.
Original annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1645)

Predicted SEED Role

"Transcriptional regulators"

Sequence Analysis Tools

See A0A165Z8L0 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Pf6N2E2_2427 DNA damage response gene with a putative DNA binding domain and often regulated by LexA (PA0922-like) (Pseudomonas fluorescens FW300-N2E2)
LVNVEQLKSSVNRMSADVVREAVLELRLDGLVTEGKTPFNKLHFNTCFAEIEALFQRAGY
HKQLDVVGYQGLLYALYDPGRWEAVEVLRWLKEFTEAAAKSTSVTT