Protein Info for Pf6N2E2_2399 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details PF01790: LGT" amino acids 3 to 102 (100 residues), 43.8 bits, see alignment E=4e-15 PF08534: Redoxin" amino acids 132 to 258 (127 residues), 64.2 bits, see alignment E=2.3e-21 PF00578: AhpC-TSA" amino acids 133 to 245 (113 residues), 57.2 bits, see alignment E=3.3e-19 PF00085: Thioredoxin" amino acids 157 to 203 (47 residues), 27.1 bits, see alignment 6.8e-10

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1670)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYB2 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Pf6N2E2_2399 Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase (Pseudomonas fluorescens FW300-N2E2)
MLTFTLGTFAIALNHLLLISALALATFVGWRVAKRGGENPESVLFVLFLLGLLAARVGFV
VAYWQHYRDDPWQIVDLRDGGFLAWPGIVALLIAALLWARRRPPLRRPLGFGVGSGLLFW
LVATLSLTIYEQGTRLPDITLRTADGETVKLTDYQGGPLVINLWATWCPPCRREMPVLEE
AQQQRPDLTFLFVNQAESMQSVSTYLATQGLSLDNVLFDGSGRLGQAVGSMALPTTLFYS
ADGHLLGSHLGELSEASLARALENFETPDLSITPHSATRKTPCPASATC