Protein Info for Pf6N2E2_2397 in Pseudomonas fluorescens FW300-N2E2

Annotation: Two-component system response regulator QseB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 97.9 bits, see alignment E=4.2e-32 PF00486: Trans_reg_C" amino acids 145 to 216 (72 residues), 74.1 bits, see alignment E=8e-25

Best Hits

Swiss-Prot: 44% identical to PMRA_PECPM: Transcriptional regulatory protein PmrA (pmrA) from Pectobacterium parmentieri

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1672)

Predicted SEED Role

"Two-component system response regulator QseB" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXK3 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Pf6N2E2_2397 Two-component system response regulator QseB (Pseudomonas fluorescens FW300-N2E2)
MRVLVCEDDELIASGIVAGLTAQGLTVEHVATASAARAMVGVAEFDVMVLDLGLPDEDGL
KLLRQLRQQGMQTPVLILTARDSVTDRVDGLQAGADDYLLKPFDLRELAARLHTLLRRVA
GRSVNLIEHGRLTYDPSSRETTLDGQPVDLSRREQSLLQALLHSRGRVLSTEQLKDSVYG
FNDELESNALNVHIHHLRRKLGNGIVETVRGLGYRLGPAEGGEPSK