Protein Info for Pf6N2E2_2382 in Pseudomonas fluorescens FW300-N2E2

Annotation: Major porin and structural outer membrane porin OprF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05736: OprF" amino acids 1 to 179 (179 residues), 305.9 bits, see alignment E=1.9e-95 PF13505: OMP_b-brl" amino acids 14 to 175 (162 residues), 41.4 bits, see alignment E=3.6e-14 PF03922: OmpW" amino acids 38 to 117 (80 residues), 24.9 bits, see alignment E=3.6e-09 PF00691: OmpA" amino acids 238 to 333 (96 residues), 86.5 bits, see alignment E=2.6e-28

Best Hits

Swiss-Prot: 88% identical to PORF_PSESY: Outer membrane porin F (oprF) from Pseudomonas syringae pv. syringae

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 99% identity to pba:PSEBR_a1684)

Predicted SEED Role

"Major porin and structural outer membrane porin OprF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVM8 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Pf6N2E2_2382 Major porin and structural outer membrane porin OprF (Pseudomonas fluorescens FW300-N2E2)
MKLKNTLGFAIGSLIAATSFGALAQGQGAVEIEGFAKKEQFDSARNFKNNGNLFGGSVGY
FLTDDVELRLAYDEVHNARTDDGTNVKGANTALDALYHFNNPGDMLRPYVSAGFSDQSID
QNGSNGRNRSTFANVGGGAKLYFTENFYARAGVEAQYNIDQGDTEWAPSVGIGVNFGGGS
KPAAAPVPAPAEVCSDSDNDGVCDNVDKCPDTPANVTVDADGCPAVAEVVRVELDVKFDF
DKSVVKPNSYGDIKNLADFMKQYPSTSTTVEGHTDSVGPDAYNQKLSERRAKAVQQVLTN
QYGVESSRVQAVGYGESRPVADNATEAGRAVNRRVEAQVEAQAK