Protein Info for Pf6N2E2_2376 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): nitrate transporter
Rationale: Specific phenotype: utilization of nitrate. Similar B.subtilis nasA, which is a nitrate transporter (not a nitrate/nitrite antiporter)
Original annotation: Nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 332 to 356 (25 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 13 to 347 (335 residues), 312.5 bits, see alignment E=2e-97 PF07690: MFS_1" amino acids 23 to 349 (327 residues), 157 bits, see alignment E=6.3e-50 PF13347: MFS_2" amino acids 146 to 319 (174 residues), 33 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to pba:PSEBR_a1690)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D9B111 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Pf6N2E2_2376 nitrate transporter (Pseudomonas fluorescens FW300-N2E2)
MNSSFWKSGHTPTLFAAFLYFDLSFMVWYLLGPLAVQISADLHLTTQQRGLMVATPILAG
AVLRLFMGLLADRISPKTAGMVGQVIVIGALFCAWKLGIHSYEQALLLGLFLGVAGASFA
VALPLASQWYPPQHQGKAMGIAGAGNSGTVLAALIAPVMAVAFGWSNVFGFALIPLVLTL
VLFAWLAKNAPERPKAKSMADYLKALGDRDSWWFMFFYSVTFGGFIGLASALPGYFNDQY
GLSPVTAGYYTAACVFGGSLMRPLGGALADRFGGIRTLLGMYTVAAVCIAAVGFNLPSSY
AALALFVCTMLGLGAGNGAVFQLVPQRFRREIGVMTGLIGMAGGIGGFALAAGMGAIKQS
TGSYQLALWLFASLGVLAWFGLHGVKRRWRTTWGSAAVTAARV