Protein Info for Pf6N2E2_2371 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type III secretion outermembrane contact sensing protein (YopN,Yop4b,LcrE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 TIGR02568: type III secretion regulator YopN/LcrE/InvE/MxiC" amino acids 38 to 259 (222 residues), 144.1 bits, see alignment E=5.9e-46 PF07201: HrpJ" amino acids 50 to 207 (158 residues), 98.8 bits, see alignment E=2.2e-32

Best Hits

KEGG orthology group: K04058, type III secretion protein SctW (inferred from 50% identity to cvi:CV_2631)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZX70 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Pf6N2E2_2371 Type III secretion outermembrane contact sensing protein (YopN,Yop4b,LcrE) (Pseudomonas fluorescens FW300-N2E2)
MMLPPVSLGGRAAQARLNAEKAAEHPQPPVDAETPEDSATAAVAQRLVQISDELSAALTQ
FRGRRLFELKSEAMTDTFERVLEDDTVPKARQVLSLARLADKPVAWLLQMARSLFPDDSD
LALVLRALLRRKNLETLTRQRLETLLQTVVAQGSPKRLNAGINAALKARMFGKSLAVRAG
LLRESYRDFLESDEGPLSCYQDWIALYGPSQRQGVLAFIEAALLTDISAQDPSCSRVEFG
QLLARVTDLKRLRSADEQFIGAVLGDAVICRHNPDESDWLVFFFGVLTYPDDLDQLLLGA
LGEQVLLSAHRERSILLQTLRRLSLRLPLPLFADEEAPQRLATQFTRLADVAYAHECIDQ
RRSGGCP