Protein Info for Pf6N2E2_2370 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 685 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details TIGR01399: type III secretion protein, HrcV family" amino acids 14 to 684 (671 residues), 859.9 bits, see alignment E=7.4e-263 PF00771: FHIPEP" amino acids 26 to 677 (652 residues), 708 bits, see alignment E=6.7e-217

Best Hits

Predicted SEED Role

"Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z865 at UniProt or InterPro

Protein Sequence (685 amino acids)

>Pf6N2E2_2370 Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV) (Pseudomonas fluorescens FW300-N2E2)
MTLLNGFLRNVGARPELLILTLMVMIIAMLIIPLPTVLVDFLIGLNIVISLLVFMGSFYI
ERILSYSTFPALLLLTTLFRLALSISTSRLILSQADAGEIIASFGDFVIGESLVVGFVIF
SIVTIVQFIVITKGSERVAEVAARFSLDGMPGKQMSIDGDLKAGAIDAAQAREKRSVLER
ESQLYGSFDGAMKFIKGDAIAGIIIIFVNFIGGMAIGVGQLGMDLSTALSTYTLLTIGDG
LVAQIPALLIAIGAGFIVTRVNGDDSNLGRNMLTQMLGNPFVLGVTALLAVGVGLLPGFP
LLTFLSIAGVLGLVVFVRQRKSSRQASPGESRAEAAEQNTLPSESGLLDDVDNLATETIA
LMLLVPKTQLEALEKQRWAARFRSQFFVDYGLRIPEPRLRASEALPAHQVAVLINEVRAE
QFDIHFDHWRLLDYSPELDPLGFALVRGNDSNRLGGVWVSAADRERVQQLGYHLRPADEE
CYRCLVTLLARNIQEFFGVQETKQLLDEMETRCPDLLKEVYRHVTVQKIAEVLQRLIGER
ISVRNMKLILESLAHWASREKDVLALVEHVRGAMARYISNKFAQGNDLRVLLLSPEFEEV
VRRGIRQTSGGSFLNLEPAESEELMDRLSVGLDSVHIAHKDMVLLCSVDVRRYIKKLIEG
RFRELDVMSFGEISESVSVNVIKTL