Protein Info for Pf6N2E2_2369 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellum-specific ATP synthase FliI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR01026: ATPase, FliI/YscN family" amino acids 3 to 415 (413 residues), 432.3 bits, see alignment E=9.8e-134 PF02874: ATP-synt_ab_N" amino acids 4 to 67 (64 residues), 24.2 bits, see alignment E=6.2e-09 PF00006: ATP-synt_ab" amino acids 126 to 335 (210 residues), 265.3 bits, see alignment E=5.9e-83 PF18269: T3SS_ATPase_C" amino acids 342 to 413 (72 residues), 58.3 bits, see alignment E=8.3e-20

Best Hits

Swiss-Prot: 62% identical to SPAL_SALTY: Probable ATP synthase SpaL (spaL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 67% identity to cvi:CV_2628)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZD8 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Pf6N2E2_2369 Flagellum-specific ATP synthase FliI (Pseudomonas fluorescens FW300-N2E2)
LRLSGPLIEAALPGVVVGEVCEVRRHWRSPEVAARAQVIGFKPGAVLLSLLGDGRGLSRE
SMIVPTGSTLQLACSDALLGSVVDPQGRIVERLAPSTAVAQRDCPVDADPPPYQQRRPVA
EPLRTGIRVIDGLLTCGVGQRIGIFAAAGSGKTTLINMLIEHTDAEVFVIGLIGERGREV
TEFIAHLRQSPKHSRCVVVFATSDFSSVDRCNSALQATTIAEYFRDQGWRVVLLLDSLTR
YARARRDLALAAGEAPARRGYPASVFDALPRLLERPGVTATGSITAWYTVLLESDDEPDP
IAEEIRSILDGHVYLSRALAAKGHYPAIDVLRSVSRVATQVTTPQVQQLAASTRETLARL
EQLQVFLDMGEYSPGVDAANDRAMHRRDALDRWLRQPTGECCEPDETLRSLHEILA