Protein Info for Pf6N2E2_2365 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 6 to 210 (205 residues), 256.1 bits, see alignment E=1.2e-80 PF00813: FliP" amino acids 9 to 210 (202 residues), 201.4 bits, see alignment E=7.3e-64

Best Hits

Swiss-Prot: 66% identical to SPAP_SHISO: Surface presentation of antigens protein SpaP (spaP) from Shigella sonnei

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 72% identity to cvi:CV_2624)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXI0 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Pf6N2E2_2365 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components) (Pseudomonas fluorescens FW300-N2E2)
MNDVSLIALLAFASLLPFLVAAGTCYLKFSIVFVIVRNALGLQQVPSNMALNAIALMLAV
FVMTPVVKQGHDYYKTEAVAFTDIESVVNFAENGLGSYKDYLRKYTDPELALFFERAQAV
QDETDADWPVDEELAPSLFSLLPAYALSEIKSAFKIGFYLYLPFVIVDLVISSILLALGM
MMMSPVIISVPIKLVLFVALDGWALLSTGLVKQYLTLLA