Protein Info for Pf6N2E2_2363 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details TIGR01401: type III secretion apparatus protein SpaR/YscT/HrcT" amino acids 14 to 247 (234 residues), 244.2 bits, see alignment E=8e-77 PF01311: Bac_export_1" amino acids 14 to 233 (220 residues), 157.6 bits, see alignment E=2e-50

Best Hits

Swiss-Prot: 52% identical to SPAR_SALTY: Surface presentation of antigens protein SpaR (spaR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 52% identity to see:SNSL254_A3093)

Predicted SEED Role

"Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z851 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Pf6N2E2_2363 Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components) (Pseudomonas fluorescens FW300-N2E2)
MAVTLFFELYAGFAAALLGVARLAPIFFMLPFLNSGVLTGVARQAVIVLVALGFWAYVGV
PTPALDSLAFLGLMLREVSIGVLLGVLLCWPFWVLHAMGNLIDNQRGAMLSSTVDPANGV
DTSELANFLQLFAAAVYLEGGGMLLMLETVAQSYRICAPANDCAIHLSALHALLDVLVSK
TLVISAPVVATLLVSEALLGLLSRYAPQMNAFSVSLTVKSLVALVVLMLYFGVHLPDEVL
RMGGMSEGLAQSLGDGEGDHVIQRLED