Protein Info for Pf6N2E2_2362 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 73 to 100 (28 residues), see Phobius details amino acids 140 to 156 (17 residues), see Phobius details amino acids 176 to 201 (26 residues), see Phobius details TIGR01404: type III secretion protein, YscU/HrpY family" amino acids 6 to 341 (336 residues), 380.4 bits, see alignment E=4.6e-118 PF01312: Bac_export_2" amino acids 6 to 337 (332 residues), 265.6 bits, see alignment E=3.5e-83

Best Hits

Swiss-Prot: 59% identical to SPAS_SALTY: Surface presentation of antigens protein SpaS (spaS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03229, type III secretion protein SctU (inferred from 64% identity to cvi:CV_2621)

Predicted SEED Role

"Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVE7 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Pf6N2E2_2362 Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components) (Pseudomonas fluorescens FW300-N2E2)
MSSSASKTEKPTAKRLRDAARKGQTFKAKDLVITCLTLCGISYLVFNSSLFEIMEVYRRI
IASDFDVELQTYSAMLVLVGLKTLLPLLLVCVLTSALPALLQSGFALASEALKLNLGALN
PINGFKKLFSLRTVKDTFKALLYLGSFAMALWIVWVTQRQLLFAQLFAQAADLFAIWGHL
LLVLVLAFLACILLIVVLDALSEYGLFMKDQMMDKDAVKREHKEQDGNPQIKGRRRDLHM
ELLSEQVKSDVRSSRMIIANPTHIAIGVYFRPEITLLPFISLMETNQRALAVRAYAKAVG
VPVINDKALARRIFKTHQRYSFLQVQEVEEVLRLLIWLEQVEQA