Protein Info for Pf6N2E2_2352 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type III secretion bridge between inner and outermembrane lipoprotein (YscJ,HrcJ,EscJ, PscJ)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 208 to 227 (20 residues), see Phobius details TIGR02544: type III secretion apparatus lipoprotein, YscJ/HrcJ family" amino acids 5 to 192 (188 residues), 213.5 bits, see alignment E=1.2e-67 PF01514: YscJ_FliF" amino acids 22 to 185 (164 residues), 45.6 bits, see alignment E=3.8e-16

Best Hits

Swiss-Prot: 55% identical to PRGK_SALTY: Lipoprotein PrgK (prgK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03222, type III secretion protein SctJ (inferred from 57% identity to cvi:CV_2420)

Predicted SEED Role

"Type III secretion bridge between inner and outermembrane lipoprotein (YscJ,HrcJ,EscJ, PscJ)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVD9 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Pf6N2E2_2352 Type III secretion bridge between inner and outermembrane lipoprotein (YscJ,HrcJ,EscJ, PscJ) (Pseudomonas fluorescens FW300-N2E2)
MKAGVVLLLLGLALAGCRQPSLLEGLDQQQANEVLSVLQRNNIAAVKVDAGKAGYAVKID
QSDFSAAVDLLNLYSLPSRPRLQVAEMFPADSLVASPRAEKARLYSALEQRIEQSLAVLE
GVVSARVHVSYDLDAGEGGRKSPPIHLSAVVLHERDVEPQLLITDIKRFLKNSFAAVEYE
NVSVVLSKRAPIQHVAPTVTASQGHSGWPWWLALIGGLLLAAGAWVYRQANAGRRDDGR