Protein Info for Pf6N2E2_2348 in Pseudomonas fluorescens FW300-N2E2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 141 to 161 (21 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GMQ1 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Pf6N2E2_2348 hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MQIVNGASVPTRAVQSDFVSSSNGSAGALETLDAGKLDTSGFELSRLGSPKQIAAGLEHL
DRAAAIGLESLATYQGQEDLVIRSRISEFVEEGNLPAERSGIFSFIDEGAAGTGNREDRL
KAVLEAGLELLEAAKGPGLNLLNVAGHTGMIIALATGLRQYVGYLVEQAMREGDTPEAAR
TWATVALAMIGPALTLMGAVRREVAGESTWKSWAGSLFMAIAVFGSTLGAVLTGAAAKLF
PTMAGGVVYIMARALAQSFFTLKDNAGPANAAVTGVTAAAYGAVQFALAELGKAMPLSGP
ARAAEGLGYNFGADVIQAALNALGMIADVATFTACKSLDVLSRKLGPDSVFSDPESLQQM
ALEVRAGVQWPTRTQLADAFINVAGARLSFGHTVSLFVGAAAALLSESEIGEDAQGHVLN
GCFAVMMMLLYFPLIFINLKATGRTFTPEGINTP