Protein Info for Pf6N2E2_2325 in Pseudomonas fluorescens FW300-N2E2

Annotation: Recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 TIGR00615: recombination protein RecR" amino acids 8 to 202 (195 residues), 238.4 bits, see alignment E=2.4e-75 PF21176: RecR_HhH" amino acids 13 to 57 (45 residues), 77.5 bits, see alignment 1.4e-25 PF02132: RecR_ZnF" amino acids 60 to 80 (21 residues), 29.7 bits, see alignment (E = 1.1e-10) PF13662: Toprim_4" amino acids 87 to 177 (91 residues), 87.4 bits, see alignment E=1.5e-28 PF01751: Toprim" amino acids 88 to 169 (82 residues), 48.1 bits, see alignment E=2.6e-16 PF21175: RecR_C" amino acids 179 to 202 (24 residues), 36.3 bits, see alignment (E = 7.1e-13)

Best Hits

Swiss-Prot: 96% identical to RECR_PSEPF: Recombination protein RecR (recR) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K06187, recombination protein RecR (inferred from 100% identity to pba:PSEBR_a1715)

MetaCyc: 64% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZW43 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Pf6N2E2_2325 Recombination protein RecR (Pseudomonas fluorescens FW300-N2E2)
MSDISSMSFSPLIRQLIDALRTLPGVGQKTAQRMALQLLERDRSGGSRLAQALSQAMEGV
GHCRLCRTLTEDDLCPQCADPRRDDSLLCVVEGPMDVYAVEQTGFRGRYFVLKGHLSPLD
GLGPEAIGIPQLIARIEEAGTFTEVILATNPTVEGEATAHYIAQLLNNKGLIASRIAHGV
PLGGELELVDGGTLAHSFAGRKPIAL