Protein Info for Pf6N2E2_2320 in Pseudomonas fluorescens FW300-N2E2

Annotation: Heavy-metal-associated domain (N-terminus) and membrane-bounded cytochrome biogenesis cycZ-like domain, possible membrane copper tolerance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details PF13386: DsbD_2" amino acids 11 to 213 (203 residues), 194.9 bits, see alignment E=1.5e-61

Best Hits

KEGG orthology group: K09792, hypothetical protein (inferred from 99% identity to pba:PSEBR_a1719)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z7U9 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Pf6N2E2_2320 Heavy-metal-associated domain (N-terminus) and membrane-bounded cytochrome biogenesis cycZ-like domain, possible membrane copper tolerance protein (Pseudomonas fluorescens FW300-N2E2)
MLDLAPLLVSAVILGLLGGGHCLGMCGGLMGALTLAIPKEQRSRRFRLLLAYNLGRILSY
ATAGLLIGLAGWAVSNSPAAMIMRVLAGLLLIAMGLYLAGWWSGLTRIESIGRGLWRHIQ
PVANRLLPVSSLPRALLLGALWGWLPCGLVYSTLLWSASQGNALDSALLMLAFGLGTWPV
LLATGLAAERVTALLRKRSVRMAGGLLVIIFGAWTLPGPHQHWLMGH