Protein Info for Pf6N2E2_2316 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 43 to 63 (21 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 39 to 468 (430 residues), 589.8 bits, see alignment E=1.7e-181 PF13746: Fer4_18" amino acids 217 to 322 (106 residues), 151.2 bits, see alignment E=3.8e-48 PF11614: FixG_C" amino acids 352 to 468 (117 residues), 107 bits, see alignment E=2.1e-34

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1723)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z7U6 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Pf6N2E2_2316 Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation (Pseudomonas fluorescens FW300-N2E2)
MSNQIPVHDVTPPAKDANKSVDLYASREKIYTRAFTGLFRNLRMAGGALLFLLYFGTVWL
NWGGHQAVWWNLPERKFFIFGATFWPQDFILLSGMLIIAAFGLFFITVYAGRVWCGYTCP
QSVWTWIFMWCEKVTEGDRNQRIKLDKAPMGANKFLRKLAKHSLWLLIGFVTGMTFVGYF
TPIRELVFEFFTGQADGWSYFWVGFFTLATYGNAGWLREQVCIYMCPYARFQSVMFDKDT
LIVSYDPRRGESRGPRKKGVDYKALGLGDCIDCTMCVQVCPTGIDIRDGLQIECIGCAAC
IDACDNIMDKMDYPRGLISYTTEHNLSGQKTHKLRPRLIGYALVLLAMISLLVTAFFMRS
LVGFDVSKDRVLYRENAEGRIENVYSLKIMNKDQRDHTYVLEAAGLPDLKLQGRREIKVA
AGEIYSQPVELSSAPEQLPSSTNEVTFILKDADDESVHVEAKSRFIGPQTR