Protein Info for Pf6N2E2_2313 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 34 to 319 (286 residues), 246.6 bits, see alignment E=1.6e-77 PF14715: FixP_N" amino acids 37 to 83 (47 residues), 85.1 bits, see alignment 3.2e-28 PF13442: Cytochrome_CBB3" amino acids 146 to 219 (74 residues), 45.9 bits, see alignment E=8.8e-16 amino acids 235 to 312 (78 residues), 45.2 bits, see alignment E=1.5e-15 PF00034: Cytochrom_C" amino acids 149 to 221 (73 residues), 34.2 bits, see alignment E=8.2e-12 amino acids 237 to 271 (35 residues), 32.4 bits, see alignment 2.9e-11

Best Hits

KEGG orthology group: K00406, cb-type cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 99% identity to pba:PSEBR_a1724)

MetaCyc: 85% identical to cbb3-2 cytochrome c oxidase subunit P (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWW5 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Pf6N2E2_2313 Cytochrome c oxidase subunit CcoP (EC 1.9.3.1) (Pseudomonas fluorescens FW300-N2E2)
MTTFWSLYVTVLSLGTIFSLTWLLLSTRKGQRAEQTDETVGHSFDGIEEYDNPLPKWWFM
LFVGTIVFALGYLVLYPGLGNWKGLLPGYNYLDTEKQTAFANGQTGWTGVHEWEKEMARS
DAKFGPIFAKFASMPIEEVAKDPQALKMGGRLFASNCSVCHGSDAKGAYGFPNLTDADWR
WGGEPETIKTTIMGGRHAVMPGWAAVVGEQGVADVAAYLVTSLHSRKLPEGAKADPANGQ
KLFAANCVACHGPAGKGTPAMGAPDLTHPAGFIYGSSFAQLQQTIRYGRQGQMPAQADLQ
GNDKVHLLAAYVYSLSHGEKAPAADAQ