Protein Info for Pf6N2E2_231 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG00956946: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 324 to 348 (25 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 340 (325 residues), 62 bits, see alignment E=2.5e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a3641)

Predicted SEED Role

"FIG00956946: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YNS1 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Pf6N2E2_231 FIG00956946: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MNALDSIDSKKSLGAICLMMVISLGTLQIQPILGGALIDQLGLPLNAIGALFAAELMAMA
IACGVCALFMASVDRRRFALVALLILALGNLASTQLHSQAGLVISRMICGASGGAVMAVV
YATAALRTSKDATFAIINIGNLLWGMLLVTSMPLVLQAFGVNGAFSLLAITSVLAALGCW
RVPKRYPDAHRAANGSIQPFGLTAMLLILLFALLFFGHSALWVYQERIGRSIGLEPQQIG
GILGGSILAGALGAGLAGLIGRRLGLLFPQLLSFGTALLATLIMVYGTSPVAFITTACLI
HMVWFFSLPYLLSMAAELDPSGRLAGLGNAAIFIGQGLGPFGAALVVGEGHLRAVGWLAA
SAYLLALVISCLVVARFRRGVKPSGPAMSPQSA