Protein Info for Pf6N2E2_2302 in Pseudomonas fluorescens FW300-N2E2

Annotation: CAAX amino terminal protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 101 to 116 (16 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 232 to 258 (27 residues), see Phobius details PF02517: Rce1-like" amino acids 157 to 251 (95 residues), 64.1 bits, see alignment E=5.9e-22

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 98% identity to pba:PSEBR_a1734)

Predicted SEED Role

"CAAX amino terminal protease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWV5 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Pf6N2E2_2302 CAAX amino terminal protease family protein (Pseudomonas fluorescens FW300-N2E2)
MPALPWPYLAMLAIGYGLALAYGQLAWTALISVALLLFAGYAVRQQPMPIGRFLGHILFV
VLALALALHWMPGFFNGRAIPAQRLTDDAAPFAMYLNQDKPLIGFWLLLACPWIVGRRSF
RLSVYATALGLALSAVLALGGAMLLGMIHWAPKWPEHAWLWVLNNLLLVTLVEEALFRGY
IQGGLSRRFKHLGYGDNLALLLTSLLFGLVHAGAGWQWVLLSGLAGVGYGLAYRFGGLGA
AIATHFLLNLLHFALFTYPMLA