Protein Info for Pf6N2E2_2295 in Pseudomonas fluorescens FW300-N2E2

Annotation: Lipid A export ATP-binding/permease protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 66 to 89 (24 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 6 to 581 (576 residues), 885.8 bits, see alignment E=7.2e-271 PF00664: ABC_membrane" amino acids 27 to 292 (266 residues), 172.6 bits, see alignment E=1.5e-54 PF00005: ABC_tran" amino acids 362 to 510 (149 residues), 111.5 bits, see alignment E=4.9e-36

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1741)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z7N9 at UniProt or InterPro

Protein Sequence (590 amino acids)

>Pf6N2E2_2295 Lipid A export ATP-binding/permease protein MsbA (Pseudomonas fluorescens FW300-N2E2)
MLSSRHRRAIRLASGFIAPYRKQVAGALLALIVTAGITLSMGQGIRLLVDQGFMTRSPHL
LNQSIGLFMVLVVGLAIGTFARFYLVSWIGERVVADIRRQVFNHLVYLHPGFYENNRSSE
IQSRLTADTTLLQSVIGSSLSLFLRNALMVVGGIVLLFITNPKLTSIVVIALPLVLAPIL
VFGRRVRSLSRQSQDRIADVGSYVSETLGQIKTVQAYNHQVQDEQRFSVTVEQAFDTARK
RIAQRAWLITLVIVLVLGAVGVMLWVGGMDVIAGRISGGELAAFVFYSLIVGSAFGTLSE
VIGELQRAAGAAERIAELLRSQNIIQPPASGLVTLPERVRGDLRLEGVRFSYPSRPDSYA
VDGLDLTIKAGETLALVGPSGAGKSTVYDLLLRFYDPVQGQILIDDVPLTRLDPLDLRRH
FALVSQNPALFFGTVEENIRYGNPGATSEQVREAAQIAHAHDFIEKMPGGYQTHLGDGGQ
GLSGGQRQRLAIARALLVDAPILLLDEATSALDAQSEHLIQQALPNLMKNRTTLVIAHRL
ATVKNADRIAVMDQGKVVAVGTHQELVASNALYARLAALQFNVGLESTAD