Protein Info for Pf6N2E2_2292 in Pseudomonas fluorescens FW300-N2E2

Annotation: Universal stress protein family COG0589

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF00582: Usp" amino acids 3 to 141 (139 residues), 112.2 bits, see alignment E=1.6e-36

Best Hits

Swiss-Prot: 39% identical to USPA1_COXBU: Universal stress protein A homolog 1 (uspA1) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K06149, universal stress protein A (inferred from 94% identity to pba:PSEBR_a1745)

Predicted SEED Role

"Universal stress protein family COG0589" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWU8 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Pf6N2E2_2292 Universal stress protein family COG0589 (Pseudomonas fluorescens FW300-N2E2)
MYYNHVLVAVDLTEECDPVVKRARALCDGRDTKLSLVHIVEPMAMAFGGDVPMDLSQLQQ
QQFDQAKERLERLIVKYPDLKKENCHLTYGQPRQEIHHLAKEQGCDLIVVGSHGRHGLAL
LLGSTANDVLHGAPCDVLAVHLVKRS