Protein Info for Pf6N2E2_2276 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 46 to 71 (26 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 157 to 174 (18 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 13 to 218 (206 residues), 94.4 bits, see alignment E=7.6e-31 amino acids 220 to 383 (164 residues), 33.9 bits, see alignment E=1.8e-12 PF07690: MFS_1" amino acids 16 to 369 (354 residues), 103.1 bits, see alignment E=1.6e-33 amino acids 262 to 422 (161 residues), 39.4 bits, see alignment E=3.7e-14

Best Hits

Swiss-Prot: 64% identical to CITA_ECOLX: Citrate-proton symporter (citA) from Escherichia coli

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1761)

MetaCyc: 62% identical to propane-1,2,3-tricarboxylate-proton symporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-49

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVE9 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Pf6N2E2_2276 Permeases of the major facilitator superfamily (Pseudomonas fluorescens FW300-N2E2)
MSSQTSNGKAIFRVVSGNFLEMFDFMVYGFYATAIAKTFFPADSAFASLMLSLATFGAGF
LMRPLGAIFLGAYIDRHGRRKGLIITLAMMAAGTVLIACVPGYATLGVAAPLLVLLGRLL
QGFSAGVELGGVSVYLAEISTPGRKGFFVSWQSASQQAAVVFAGLLGVGLNHWLSPQEMG
EWGWRVPFLVGCMIVPAIFVIRRSLEETPEFQARKHRPSLSEIVRSIGQNFGIVLAGMAL
VVMTTVSFYLITAYTPTFGKAELNLSDLDALLVTVCIGLSNFFWLPVMGALSDKVGRKPL
LLGATVLAILTAYPALSWLVANPSFSHLLIVELWLSFLYGSYNGAMVVALTEIMPVEVRT
TGFSLAYSLATATFGGFTPAACTYLIHVLDNKAAPGIWLSGAAVLGLIATLVLFKGDRHE
LRTAQASVVGGA