Protein Info for Pf6N2E2_2270 in Pseudomonas fluorescens FW300-N2E2

Annotation: Lipoprotein releasing system transmembrane protein LolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 233 to 257 (25 residues), see Phobius details amino acids 278 to 314 (37 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 1 to 376 (376 residues), 496.6 bits, see alignment E=2.9e-153 PF12704: MacB_PCD" amino acids 2 to 157 (156 residues), 42.7 bits, see alignment E=8.2e-15 PF02687: FtsX" amino acids 236 to 369 (134 residues), 70.9 bits, see alignment E=9.4e-24

Best Hits

Swiss-Prot: 45% identical to LOLC_NEIMB: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to pba:PSEBR_a1766)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWT1 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Pf6N2E2_2270 Lipoprotein releasing system transmembrane protein LolC (Pseudomonas fluorescens FW300-N2E2)
MIVVLSVMNGFDHEMRTRVLGMVPHATLESGEAISDWPSLAAKVKQNPQVLAVAPFTQMQ
GLLTNDGKVSKVLLNGIDPGLERQVSIIDNFMQQGKLDDLAPGSFGIVIGDKAAAKLGVA
IGDKLTFVAPEVTVTPGGMFPRMKRFTVVGIFHVGAGELDGYLGVTNLQDLARLHRWKPD
QVQGLRLKFDDLFQAPRVAWTIAQQLGEDRYYARDWTRTHGNLYQAIRMEKAMIGLLLLL
IVAVAAFNIISTLVMVVNDKKGDIAILRTLGATPGQIMRIFMVQGTVIGVIGTFVGALVG
MFAALNVSAAIAALEGLIGHKFLNADVYFIDYLPSQLQVDDVLMVCGAALVLSFLATLYP
AWRAARTQPAEALRYE