Protein Info for Pf6N2E2_2258 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transaldolase (EC 2.2.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00874: transaldolase
  • amino acids 4 to 308 (305 residues), 463 bits, E=2.7e-143
• PF00923: TAL_FSA
  • amino acids 14 to 303 (290 residues), 325.7 bits, E=1.3e-101

Best Hits

Swiss-Prot: 93% identical to TAL_PSEPF: Transaldolase (tal) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to pba:PSEBR_a1778)

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• Bifidobacterium shunt (14/15 steps found)
• pentose phosphate pathway (8/8 steps found)
• Rubisco shunt (9/10 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

See A0A159ZZ40 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Pf6N2E2_2258 Transaldolase (EC 2.2.1.2) (Pseudomonas fluorescens FW300-N2E2)
MTSKLEQLKQFTTVVADTGDFEAIARVKPVDATTNPSLLLKASAIPGYAEQLNACVADCK
GDVGLASDRFAVAVGQEILKVIPGRISTEVDARLSFDTEAMLKRAHRLIDLYEKAGIGRE
RVLIKIASTWEGIRAAEQLEREGIQCNLTLLFSFAQAAACADAGVFLISPFVGRIYDWYK
KANGNDYTGADDPGVQSVTRIYNYYKANDYKTVVMGASFRNLNQIEQLAGCDRLTVSPDL
LEKLAADEGKLERKLAPGQAGEARLILNEAQFRWLSNEDAMATEKLAEGIRQFARDQEKL
EALLQAKL