Protein Info for Pf6N2E2_2251 in Pseudomonas fluorescens FW300-N2E2

Annotation: NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details PF03824: NicO" amino acids 16 to 291 (276 residues), 157.3 bits, see alignment E=5.7e-50 PF13386: DsbD_2" amino acids 183 to 263 (81 residues), 35.6 bits, see alignment E=9e-13

Best Hits

Swiss-Prot: 64% identical to RCNA_SALTY: Nickel/cobalt efflux system RcnA (rcnA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08970, nickel/cobalt exporter (inferred from 80% identity to pst:PSPTO_4280)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXZ6 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Pf6N2E2_2251 NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3) (Pseudomonas fluorescens FW300-N2E2)
MPNFAELLQQGGTHAWLYFPSAILLGALHGLEPGHSKTMMAAFIVAIRGSVKQAVLLGLA
ATLSHTVVVWLVAIGGMYLGQGLDAETTEPYFQLASAALIVAIALWMLWRTWRGERMFRF
QQGHDHHHHHDHDHDHDHDHDHDHDHDHHHEHDHGHPEPKGLVLSLEGYQDAHEQAHAND
IRKRFTNRQVTTGQIIVFGLTGGLIPCPAAITVLLLCLQVKEVALGGLLVLCFSIGLAIT
LVTVGAAAAIGARQASNRWPWLGTVARRAPYLSSVLIIGVGLYVGIHGWIGLNA