Protein Info for Pf6N2E2_2249 in Pseudomonas fluorescens FW300-N2E2

Annotation: Proton/glutamate symport protein @ Sodium/glutamate symport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 300 to 332 (33 residues), see Phobius details amino acids 340 to 366 (27 residues), see Phobius details PF00375: SDF" amino acids 2 to 393 (392 residues), 380.5 bits, see alignment E=4.9e-118

Best Hits

Swiss-Prot: 40% identical to DCTA_OCHA4: C4-dicarboxylate transport protein (dctA) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1786)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXA8 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Pf6N2E2_2249 Proton/glutamate symport protein @ Sodium/glutamate symport protein (Pseudomonas fluorescens FW300-N2E2)
MGIALGVLVGWACHHFAGSEQSAKEIASYFSMVTDIFLRMIKMIIAPLVFATLVGGIASM
GNSRSVGRIGARAMAWFVTASVVSLLIGMGLVNLFQPGAGLNMDVAQHATAAVPVNTGDF
SLKAFIGHVFPRSIAEAMANNEILQIVVFSLFFGFALAGVKRAGYTRITDCIEELAKVMF
KITDYVMAFAPIGVFAAIASAITTQGLGLLVDYGKLIAEFYLGILILWALLFGAGYLFLG
RSVFHLGKLIREPILLAFSTASSESAYPKTIEALEKFGAPKRVSSFVLPLGYSFNLDGSM
MYQAFAILFIAQAYNIDLSFTQQLLILLTLMVTSKGMAGVARASVVVVAATLPMFNLPEA
GLLLIIGIDQFLDMARTATNVVGNSIATAVVAKSEPHEEADEDEGAGAPVRSRSEPVPVA