Protein Info for Pf6N2E2_2246 in Pseudomonas fluorescens FW300-N2E2

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 351 (332 residues), 127.7 bits, see alignment E=2.6e-41

Best Hits

Swiss-Prot: 63% identical to OPDE_PSEAE: Transcription regulatory protein OpdE (opdE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a1790)

MetaCyc: 39% identical to purine ribonucleoside exporter (Escherichia coli K-12 substr. MG1655)
RXN0-18; RXN0-22

Predicted SEED Role

"Arabinose efflux permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV56 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Pf6N2E2_2246 Arabinose efflux permease (Pseudomonas fluorescens FW300-N2E2)
MTDNPLSQDPPAWGAVLAMSLAAFVLVASEFMPVSLLTPVAADLHVSEGQAGQGIAVSGA
FALITSLFIASIAAQVDRKWLLLGLTLLMIVSGTVVAFAPNYPVFMLGRALIGVAIGGFW
SLSAATAMRLVPDDQVPQALAIVNGGNALATVVAAPLGSFLGAIIGWRGAFFCIVPVAAI
ALVWLLLRLPSMPSQAKRGGTNVFKLMTRAPVALGMLAVSTFFMGQFMLFTYLRPFLETV
TQVSVSMLSFMLLVIGVAGLLGTFLIGVCLKNNLYRTLIVIPLLMAAIAIALVGFGGSIT
IATFLLGLWGLVATAAPVGWWTWLSRTLPEDAEAGGGLMVAIVQLAIAAGATVGGLLFDL
SGYCATFETSAAVLGVAAVLAVLAARSAVRESSSTTQATPYSTVG