Protein Info for Pf6N2E2_2244 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative merR family bacterial regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 PF01381: HTH_3" amino acids 36 to 73 (38 residues), 33.6 bits, see alignment E=3.4e-12

Best Hits

KEGG orthology group: K07726, putative transcriptional regulator (inferred from 90% identity to avn:Avin_31960)

Predicted SEED Role

"Putative merR family bacterial regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWX0 at UniProt or InterPro

Protein Sequence (95 amino acids)

>Pf6N2E2_2244 Putative merR family bacterial regulatory protein (Pseudomonas fluorescens FW300-N2E2)
MSKFFDELMESVQQMDEIVRGERQPSREFIVDALQVKEIRKATGLTQAKFAALIDVQLGT
LRNWEQGRREPTGPAKALLRAIHNDPKHVISALAV